PSMA1 anticorps
-
- Antigène Voir toutes PSMA1 Anticorps
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK
- Top Product
- Discover our top product PSMA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMA1 Blocking Peptide, catalog no. 33R-6001, is also available for use as a blocking control in assays to test for specificity of this PSMA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
- Autre désignation
- PSMA1 (PSMA1 Produits)
- Synonymes
- anticorps PSMA1, anticorps pros30, anticorps DDBDRAFT_0204226, anticorps DDBDRAFT_0214956, anticorps DDB_0204226, anticorps DDB_0214956, anticorps C2, anticorps HC2, anticorps Pros-30, anticorps alpha-type, anticorps NU, anticorps PROS30, anticorps CC2, anticorps zgc:92726, anticorps 143314_at, anticorps Alpha-6, anticorps CG4904, anticorps Dmel\CG4904, anticorps PROS-35, anticorps PROS-Dm35, anticorps Pros-35, anticorps Pros-Dm35, anticorps Prosalpha6, anticorps alpha6, anticorps alpha_dm, anticorps anon-SAGE:Wang-116, anticorps pros 35, anticorps pros35, anticorps proteasome subunit alpha 1, anticorps proteasome subunit alpha type 1, anticorps 20S proteasome subunit C2, anticorps proteasome (prosome, macropain) subunit, alpha type 1, anticorps proteasome subunit alpha 1 L homeolog, anticorps Proteasome alpha6 subunit, anticorps PSMA1, anticorps psma1, anticorps CNB05540, anticorps psmA1, anticorps Psma1, anticorps psma1.L, anticorps Prosalpha6
- Sujet
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.
- Poids moléculaire
- 29 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-