PAIP1 anticorps

N° du produit ABIN629948

Détail du produit anti-PAIP1 anticorps

Antigène: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAIP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAIP1 Blocking Peptide, catalog no. 33R-2650, is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAIP1

Antigène: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Autre désignation: PAIP1 (PAIP1 Produits)

Synonymes: anticorps fb53g01, anticorps zgc:91954, anticorps wu:fb53g01, anticorps poly(A) binding protein interacting protein 1, anticorps polyadenylate binding protein-interacting protein 1, anticorps poly(A) binding protein interacting protein 1 S homeolog, anticorps PAIP1, anticorps paip1, anticorps Paip1, anticorps paip1.S

Sujet: PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.

Poids moléculaire: 44 kDa (MW of target protein)