GRSF1 anticorps (N-Term)
-
- Antigène Voir toutes GRSF1 Anticorps
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GRSF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GRSF1 antibody was raised against the N terminal of GRSF1
- Purification
- Purified
- Immunogène
- GRSF1 antibody was raised using the N terminal of GRSF1 corresponding to a region with amino acids SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL
- Top Product
- Discover our top product GRSF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GRSF1 Blocking Peptide, catalog no. 33R-8338, is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
- Autre désignation
- GRSF1 (GRSF1 Produits)
- Sujet
- GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.
- Poids moléculaire
- 47 kDa (MW of target protein)
-