PCBP2 anticorps

N° du produit ABIN629951

Détail du produit anti-PCBP2 anticorps

Antigène: PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCBP2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCBP2 Blocking Peptide, catalog no. 33R-9591, is also available for use as a blocking control in assays to test for specificity of this PCBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCBP2

Antigène: PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))

Autre désignation: PCBP2 (PCBP2 Produits)

Synonymes: anticorps HNRNPE2, anticorps HNRPE2, anticorps hnRNP-E2, anticorps AW412548, anticorps Hnrpx, anticorps alphaCP-2, anticorps PCBP3, anticorps fb36h02, anticorps wu:fb36h02, anticorps zgc:55964, anticorps PCBP2, anticorps poly(rC) binding protein 2, anticorps poly(rC) binding protein 2 L homeolog, anticorps PCBP2, anticorps Pcbp2, anticorps pcbp2, anticorps pcbp2.L

Sujet: PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

Poids moléculaire: 40 kDa (MW of target protein)