DDX47 anticorps

N° du produit ABIN629954

Détail du produit anti-DDX47 anticorps

Antigène: DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX47 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX47 Blocking Peptide, catalog no. 33R-7625, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX47

Antigène: DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))

Autre désignation: DDX47 (DDX47 Produits)

Synonymes: anticorps ddx47, anticorps DDX47, anticorps E4-DBP, anticorps HQ0256, anticorps MSTP162, anticorps RRP3, anticorps 4930588A18Rik, anticorps C77285, anticorps DEAD-box helicase 47, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 47, anticorps DEAD-box helicase 47 L homeolog, anticorps DDX47, anticorps ddx47, anticorps Ddx47, anticorps ddx47.L

Sujet: DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 50 kDa (MW of target protein)