EIF4A3 anticorps

N° du produit ABIN629957

Détail du produit anti-EIF4A3 anticorps

Antigène: EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4A3 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX48 antibody was raised using a synthetic peptide corresponding to a region with amino acids QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX48 Blocking Peptide, catalog no. 33R-7488, is also available for use as a blocking control in assays to test for specificity of this DDX48 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4A3

Antigène: EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))

Autre désignation: DDX48 (EIF4A3 Produits)

Synonymes: anticorps DDX48, anticorps NMP265, anticorps NUK34, anticorps eIF4AIII, anticorps 2400003O03Rik, anticorps Ddx48, anticorps eIF4A-III, anticorps mKIAA0111, anticorps ddx48, anticorps nuk34, anticorps nmp265, anticorps eif4aiii, anticorps EIF4A3, anticorps eif4a3, anticorps zgc:56139, anticorps XeIF-4AIII, anticorps eif4a3-B, anticorps eukaryotic translation initiation factor 4A3, anticorps eukaryotic initiation factor 4A-III, anticorps eukaryotic translation initiation factor 4A3 S homeolog, anticorps Eukaryotic initiation factor 4A-III, anticorps EIF4A3, anticorps Eif4a3, anticorps eif4a3, anticorps LOC100185906, anticorps eif4a3.S, anticorps if4a3

Sujet: DDX48 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 45 kDa (MW of target protein)