DDX31 anticorps
-
- Antigène Voir toutes DDX31 Anticorps
- DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX31 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS
- Top Product
- Discover our top product DDX31 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX31 Blocking Peptide, catalog no. 33R-7480, is also available for use as a blocking control in assays to test for specificity of this DDX31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))
- Autre désignation
- DDX31 (DDX31 Produits)
- Synonymes
- anticorps fc62b08, anticorps si:ch211-89p1.3, anticorps wu:fc62b08, anticorps DDX31, anticorps PPP1R25, anticorps 5830444G11Rik, anticorps Gm997, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 31, anticorps DEAD-box helicase 31, anticorps DEAD-box helicase 31 L homeolog, anticorps DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31, anticorps ddx31, anticorps DDX31, anticorps ddx31.L, anticorps Ddx31
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX31 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants.
- Poids moléculaire
- 64 kDa (MW of target protein)
-