DDX46 anticorps

N° du produit ABIN629960

Détail du produit anti-DDX46 anticorps

Antigène: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX46 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX46 Blocking Peptide, catalog no. 33R-3247, is also available for use as a blocking control in assays to test for specificity of this DDX46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX46

Antigène: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Autre désignation: DDX46 (DDX46 Produits)

Synonymes: anticorps MMI9.2, anticorps MMI9_2, anticorps RNA HELICASE, anticorps fb39a03, anticorps fj67d06, anticorps wu:fb39a03, anticorps wu:fj67d06, anticorps PRPF5, anticorps Prp5, anticorps 2200005K02Rik, anticorps 8430438J23Rik, anticorps AI325430, anticorps AI957095, anticorps mKIAA0801, anticorps DEAD box RNA helicase (PRH75), anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 46, anticorps DEAD-box helicase 46, anticorps RNA helicase-like protein, anticorps PRH75, anticorps ddx46, anticorps DDX46, anticorps Ddx46, anticorps TDRD12

Sujet: DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex, it plays an important role in pre-mRNA splicing.

Poids moléculaire: 113 kDa (MW of target protein)