DDX19B anticorps

N° du produit ABIN629961

Détail du produit anti-DDX19B anticorps

Antigène: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX19B est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX19 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX19B Blocking Peptide, catalog no. 33R-3358, is also available for use as a blocking control in assays to test for specificity of this DDX19B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX19B

Antigène: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Autre désignation: DDX19B (DDX19B Produits)

Synonymes: anticorps DBP5, anticorps DDX19, anticorps RNAh, anticorps 2810457M08Rik, anticorps 4921519L13Rik, anticorps AW260119, anticorps MGC75870, anticorps DDX19B, anticorps Zd10a, anticorps ddx19, anticorps DEAD-box helicase 19B, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 19b, anticorps ATP-dependent RNA helicase DDX19B, anticorps DEAD (Asp-Glu-Ala-As) box polypeptide 19B, anticorps DEAD-box helicase 19B S homeolog, anticorps DDX19B, anticorps Ddx19b, anticorps ddx19b, anticorps LOC100054938, anticorps LOC100075859, anticorps LOC100581804, anticorps ddx19b.S

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities.

Poids moléculaire: 53 kDa (MW of target protein)