FARS2 anticorps (N-Term)

N° du produit ABIN629969

Détail du produit anti-FARS2 anticorps

Antigène: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FARS2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: FARS2 antibody was raised against the N terminal of FARS2

Purification: Purified

Immunogène: FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FARS2 Blocking Peptide, catalog no. 33R-9501, is also available for use as a blocking control in assays to test for specificity of this FARS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FARS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FARS2

Antigène: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Autre désignation: FARS2 (FARS2 Produits)

Synonymes: anticorps 2810431B21Rik, anticorps 6720478K01Rik, anticorps Fars1, anticorps COXPD14, anticorps FARS1, anticorps HSPC320, anticorps PheRS, anticorps dJ520B18.2, anticorps phenylalanine-tRNA synthetase 2 (mitochondrial), anticorps phenylalanyl-tRNA synthetase 2, mitochondrial, anticorps Fars2, anticorps FARS2

Sujet: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.

Poids moléculaire: 50 kDa (MW of target protein)