DDX1 anticorps

N° du produit ABIN629970

Détail du produit anti-DDX1 anticorps

Antigène: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX1 Blocking Peptide, catalog no. 33R-8730, is also available for use as a blocking control in assays to test for specificity of this DDX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX1

Antigène: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Autre désignation: DDX1 (DDX1 Produits)

Synonymes: anticorps CG9054, anticorps DDX1, anticorps Dbp79E, anticorps DmDDX1, anticorps DmRH12, anticorps Dmel\\CG9054, anticorps anon-79E, anticorps DBP-RB, anticorps UKVH5d, anticorps si:ch211-214k9.2, anticorps si:dkey-161f12.1, anticorps AA409185, anticorps Dead-box-1, anticorps DEAD-box helicase 1, anticorps DEAD/H-box helicase 1 L homeolog, anticorps DEAD (Asp-Glu-Ala-Asp) box helicase 1, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 1, anticorps Ddx1, anticorps DDX1, anticorps ddx1.L, anticorps ddx1

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.

Poids moléculaire: 81 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization