PTBP2 anticorps (N-Term)

N° du produit ABIN629977

Détail du produit anti-PTBP2 anticorps

Antigène: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PTBP2 antibody was raised against the N terminal of PTBP2

Purification: Purified

Immunogène: PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTBP2 Blocking Peptide, catalog no. 33R-5835, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTBP2

Antigène: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Autre désignation: PTBP2 (PTBP2 Produits)

Synonymes: anticorps PTB, anticorps PTBLP, anticorps brPTB, anticorps nPTB, anticorps nPTB5, anticorps nPTB6, anticorps nPTB7, anticorps nPTB8, anticorps Ptb2, anticorps PTBP2, anticorps im:7153495, anticorps ptbp2, anticorps si:ch211-160l17.2, anticorps wu:fa08f05, anticorps wu:fc05d10, anticorps zgc:113074, anticorps polypyrimidine tract binding protein 2, anticorps polypyrimidine tract binding protein 2b, anticorps polypyrimidine tract binding protein 2a, anticorps PTBP2, anticorps Ptbp2, anticorps ptbp2b, anticorps ptbp2a

Sujet: PTBP2 binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interactome