Cytokeratin 18 anticorps (C-Term)

N° du produit ABIN629978

Détail du produit anti-Cytokeratin 18 anticorps

Antigène: Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytokeratin 18 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Cytokeratin 18 antibody was raised against the C terminal of KRT18

Purification: Purified

Immunogène: Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 18 Blocking Peptide, catalog no. 33R-1352, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytokeratin 18

Antigène: Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))

Autre désignation: Cytokeratin 18 (KRT18 Produits)

Synonymes: anticorps CK18, anticorps K18, anticorps Krt1-18, anticorps CYK18, anticorps DreK18, anticorps cb83, anticorps dapk1, anticorps sb:cb83, anticorps wu:fa13f02, anticorps wu:fb36b04, anticorps krt18, anticorps MGC64569, anticorps MGC75922, anticorps KRT18, anticorps CK-18-A, anticorps K18-A, anticorps NC-11, anticorps cyk18, anticorps k18, anticorps krt18-a, anticorps krt18-b, anticorps krt18a, anticorps xkendob, anticorps keratin 18, anticorps keratin 18, type I L homeolog, anticorps keratin 18, type I, anticorps keratin, type I cytoskeletal 18, anticorps K18, simple type I keratin, anticorps Keratin, type I cytoskeletal 18, anticorps keratin 18, type I S homeolog, anticorps Krt18, anticorps KRT18, anticorps krt18, anticorps krt18.L, anticorps LOC700569, anticorps LOC100136778, anticorps k1c18, anticorps LOC100008885, anticorps krt18.S

Sujet: KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Apoptose, Caspase Cascade in Apoptosis