CPNE1 anticorps (N-Term)

N° du produit ABIN629980

Détail du produit anti-CPNE1 anticorps

Antigène: CPNE1 (Copine I (CPNE1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPNE1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Copine I antibody was raised against the N terminal of CPNE1

Purification: Purified

Immunogène: Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Copine I Blocking Peptide, catalog no. 33R-9369, is also available for use as a blocking control in assays to test for specificity of this Copine I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPNE1

Antigène: CPNE1 (Copine I (CPNE1))

Autre désignation: Copine I (CPNE1 Produits)

Synonymes: anticorps CPNE1, anticorps MGC108079, anticorps COPN1, anticorps CPN1, anticorps 1810028N16Rik, anticorps mKIAA4108, anticorps cpne3, anticorps cpne3l, anticorps wu:fb69d07, anticorps wu:fc45a04, anticorps zgc:55873, anticorps copine I, anticorps copine 1, anticorps RNA-binding protein 12, anticorps copine-1, anticorps copine I L homeolog, anticorps CPNE1, anticorps cpne1, anticorps CPNE1b, anticorps LOC100032499, anticorps LOC100484845, anticorps EDI_033120, anticorps LOC100281056, anticorps cpne1.L, anticorps Cpne1

Sujet: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.

Poids moléculaire: 59 kDa (MW of target protein)