NIP7 anticorps

N° du produit ABIN629985

Détail du produit anti-NIP7 anticorps

Antigène: NIP7 (Nuclear Import 7 Homolog (NIP7))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NIP7 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NIP7 Blocking Peptide, catalog no. 33R-9905, is also available for use as a blocking control in assays to test for specificity of this NIP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NIP7

Antigène: NIP7 (Nuclear Import 7 Homolog (NIP7))

Autre désignation: NIP7 (NIP7 Produits)

Sujet: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly