PABPC4 anticorps (N-Term)
-
- Antigène Voir toutes PABPC4 Anticorps
- PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PABPC4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PABPC4 antibody was raised against the N terminal of PABPC4
- Purification
- Purified
- Immunogène
- PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS
- Top Product
- Discover our top product PABPC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PABPC4 Blocking Peptide, catalog no. 33R-1137, is also available for use as a blocking control in assays to test for specificity of this PABPC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))
- Autre désignation
- PABPC4 (PABPC4 Produits)
- Sujet
- Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells.
- Poids moléculaire
- 71 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-