OLA1 anticorps

N° du produit ABIN629990

Détail du produit anti-OLA1 anticorps

Antigène: OLA1 (Obg-Like ATPase 1 (OLA1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OLA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GTPBP9 Blocking Peptide, catalog no. 33R-6110, is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OLA1

Antigène: OLA1 (Obg-Like ATPase 1 (OLA1))

Autre désignation: GTPBP9 (OLA1 Produits)

Synonymes: anticorps MGC79585, anticorps PTD004, anticorps GTPBP9, anticorps DOC45, anticorps GBP45, anticorps GTBP9, anticorps 2510025G09Rik, anticorps 2810405J23Rik, anticorps 2810409H07Rik, anticorps Gtpbp9, anticorps RGD1307982, anticorps fe36h01, anticorps wu:fc66b09, anticorps wu:fe36h01, anticorps wu:fk82a02, anticorps zgc:55768, anticorps zgc:85691, anticorps Obg-like ATPase 1, anticorps Obg like ATPase 1, anticorps Obg-like ATPase 1 L homeolog, anticorps ola1, anticorps OLA1, anticorps Ola1, anticorps ola1.L

Sujet: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Poids moléculaire: 44 kDa (MW of target protein)