SNRPF anticorps (N-Term)

N° du produit ABIN629996

Détail du produit anti-SNRPF anticorps

Antigène: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPF est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SNRPF antibody was raised against the N terminal of SNRPF

Purification: Purified

Immunogène: SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Information d'application

Indications d'application: WB: 0.31 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPF Blocking Peptide, catalog no. 33R-6466, is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPF

Antigène: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Autre désignation: SNRPF (SNRPF Produits)

Synonymes: anticorps BcDNA:GM23968, anticorps CG16792, anticorps Deb, anticorps Deb-B, anticorps DebB, anticorps Dmel\\CG16792, anticorps dF, anticorps deb-b, anticorps snRNP-F, anticorps sm-f, anticorps smf, anticorps snrpfl, anticorps SMF, anticorps Sm-F, anticorps SmF, anticorps 2010013O18Rik, anticorps sm-F, anticorps Small ribonucleoprotein particle protein SmF, anticorps small nuclear ribonucleoprotein polypeptide F, anticorps small nuclear ribonucleoprotein polypeptide F S homeolog, anticorps SmF, anticorps SNRPF, anticorps snrpf, anticorps Snrpf, anticorps snrpf.S

Sujet: SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization