SFRS8 anticorps (N-Term)
-
- Antigène Voir toutes SFRS8 (SFSWAP) Anticorps
- SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SFRS8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFRS8 antibody was raised against the N terminal of SFRS8
- Purification
- Purified
- Immunogène
- SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER
- Top Product
- Discover our top product SFSWAP Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRS8 Blocking Peptide, catalog no. 33R-6624, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))
- Autre désignation
- SFRS8 (SFSWAP Produits)
- Synonymes
- anticorps SFRS8, anticorps SWAP, anticorps 1190005N23Rik, anticorps 6330437E22Rik, anticorps AI197402, anticorps AW212079, anticorps Sfrs8, anticorps Srsf8, anticorps splicing factor SWAP, anticorps splicing factor, suppressor of white-apricot homolog (Drosophila), anticorps splicing factor SWAP homolog, anticorps SFSWAP, anticorps Sfswap
- Sujet
- SFRS8 is a human homolog of Drosophila splicing regulatory protein.
- Poids moléculaire
- 105 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-