SFRS8 anticorps (N-Term)

N° du produit ABIN629997

Détail du produit anti-SFRS8 anticorps

Antigène: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS8 est non-conjugé

Application: Western Blotting (WB)

Specificité: SFRS8 antibody was raised against the N terminal of SFRS8

Purification: Purified

Immunogène: SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS8 Blocking Peptide, catalog no. 33R-6624, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS8

Antigène: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Autre désignation: SFRS8 (SFSWAP Produits)

Synonymes: anticorps SFRS8, anticorps SWAP, anticorps 1190005N23Rik, anticorps 6330437E22Rik, anticorps AI197402, anticorps AW212079, anticorps Sfrs8, anticorps Srsf8, anticorps splicing factor SWAP, anticorps splicing factor, suppressor of white-apricot homolog (Drosophila), anticorps splicing factor SWAP homolog, anticorps SFSWAP, anticorps Sfswap

Sujet: SFRS8 is a human homolog of Drosophila splicing regulatory protein.

Poids moléculaire: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization