APOBEC2 anticorps (N-Term)

N° du produit ABIN629998

Détail du produit anti-APOBEC2 anticorps

Antigène: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOBEC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ApoBEC2 antibody was raised against the N terminal of APOBEC2

Purification: Purified

Immunogène: ApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoBEC2 Blocking Peptide, catalog no. 33R-9438, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOBEC2

Antigène: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Autre désignation: ApoBEC2 (APOBEC2 Produits)

Synonymes: anticorps MGC84761, anticorps arp1, anticorps arcd1, anticorps MGC89256, anticorps APOBEC2, anticorps DKFZp468H1727, anticorps Arp1, anticorps ARCD1, anticorps ARP1, anticorps apolipoprotein B mRNA editing enzyme catalytic subunit 2, anticorps apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 L homeolog, anticorps apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2, anticorps apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2, anticorps APOBEC2, anticorps apobec2.L, anticorps apobec2, anticorps Apobec2

Sujet: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

Poids moléculaire: 25 kDa (MW of target protein)