RPL8 anticorps (C-Term)
-
- Antigène Voir toutes RPL8 Anticorps
- RPL8 (Ribosomal Protein L8 (RPL8))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPL8 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RPL8 antibody was raised against the C terminal of RPL8
- Purification
- Purified
- Immunogène
- RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN
- Top Product
- Discover our top product RPL8 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPL8 Blocking Peptide, catalog no. 33R-2455, is also available for use as a blocking control in assays to test for specificity of this RPL8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPL8 (Ribosomal Protein L8 (RPL8))
- Autre désignation
- RPL8 (RPL8 Produits)
- Synonymes
- anticorps L8, anticorps zgc:73105, anticorps zgc:77641, anticorps CG1263, anticorps Dmel\\CG1263, anticorps M(3)62F, anticorps M(3)LS2, anticorps Rp L8, anticorps anon-EST:Posey5, anticorps rpL8, anticorps RPL8, anticorps ribosomal protein L8, anticorps ribosomal protein L8 S homeolog, anticorps Ribosomal protein L8, anticorps microRNA 6850, anticorps RPL8, anticorps Rpl8, anticorps rpl8.S, anticorps rpl8, anticorps RpL8, anticorps MIR6850
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-