RBPMS anticorps (N-Term)

N° du produit ABIN630003

Détail du produit anti-RBPMS anticorps

Antigène: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBPMS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RBPMS antibody was raised against the N terminal of RBPMS

Purification: Purified

Immunogène: RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBPMS

Antigène: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Autre désignation: RBPMS (RBPMS Produits)

Synonymes: anticorps HERMES, anticorps 2010300K22Rik, anticorps 2700019M19Rik, anticorps AU017537, anticorps hermes, anticorps RGD1561067, anticorps si:cabz01079824.1, anticorps RNA binding protein with multiple splicing, anticorps RNA binding protein gene with multiple splicing, anticorps RNA binding protein with multiple splicing L homeolog, anticorps RBPMS, anticorps Rbpms, anticorps rbpms.L, anticorps rbpms

Sujet: RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.

Poids moléculaire: 24 kDa (MW of target protein)