SNRNP70 anticorps

N° du produit ABIN630004

Détail du produit anti-SNRNP70 anticorps

Antigène: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRNP70 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRP70 Blocking Peptide, catalog no. 33R-10176, is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRP70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRNP70

Antigène: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Autre désignation: SNRP70 (SNRNP70 Produits)

Synonymes: anticorps rnpu1z, anticorps rpu1, anticorps snrp70, anticorps u170k, anticorps u1ap, anticorps u1rnp, anticorps SNRP70, anticorps wu:fc20b04, anticorps zgc:136450, anticorps 2700022N21Rik, anticorps 3200002N22Rik, anticorps 70kDa, anticorps AI325098, anticorps R74807, anticorps Rnulp70, anticorps Snrp70, anticorps Srnp70, anticorps U1-70, anticorps U1-70K, anticorps RNPU1Z, anticorps RPU1, anticorps Snp1, anticorps U170K, anticorps U1AP, anticorps U1RNP, anticorps small nuclear ribonucleoprotein, U1 70kDa subunit, anticorps small nuclear ribonucleoprotein U1 subunit 70, anticorps small nuclear ribonucleoprotein 70 (U1), anticorps small nuclear ribonucleoprotein, U1 70kDa subunit L homeolog, anticorps snrnp70, anticorps SNRNP70, anticorps Snrnp70, anticorps snrnp70.L

Sujet: SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

Poids moléculaire: 48 kDa (MW of target protein)