SNRNP35 anticorps (N-Term)

N° du produit ABIN630009

Détail du produit anti-SNRNP35 anticorps

Antigène: SNRNP35 (U11/U12 SnRNP 35 KDa Protein)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRNP35 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: U1 SNRNPBP antibody was raised against the N terminal of U1 NRNPBP

Purification: Purified

Immunogène: U1 SNRNPBP antibody was raised using the N terminal of U1 NRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

U1SNRNPBP Blocking Peptide, catalog no. 33R-7830, is also available for use as a blocking control in assays to test for specificity of this U1SNRNPBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 NRNPBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRNP35

Antigène: SNRNP35 (U11/U12 SnRNP 35 KDa Protein)

Autre désignation: U1SNRNPBP (SNRNP35 Produits)

Synonymes: anticorps MGC154877, anticorps u1snrnpbp, anticorps RGD1310724, anticorps U1snrnpbp, anticorps 6330548G22Rik, anticorps zgc:112337, anticorps HM-1, anticorps U1SNRNPBP, anticorps small nuclear ribonucleoprotein U11/U12 subunit 35 L homeolog, anticorps small nuclear ribonucleoprotein U11/U12 subunit 35, anticorps small nuclear ribonucleoprotein 35 (U11/U12), anticorps snrnp35.L, anticorps Snrnp35, anticorps snrnp35, anticorps SNRNP35

Sujet: U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.

Poids moléculaire: 28 kDa (MW of target protein)