RPL9 anticorps (C-Term)
-
- Antigène Voir toutes RPL9 Anticorps
- RPL9 (Ribosomal Protein L9 (RPL9))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPL9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPL9 antibody was raised against the C terminal of RPL9
- Purification
- Purified
- Immunogène
- RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY
- Top Product
- Discover our top product RPL9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPL9 Blocking Peptide, catalog no. 33R-3626, is also available for use as a blocking control in assays to test for specificity of this RPL9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPL9 (Ribosomal Protein L9 (RPL9))
- Autre désignation
- RPL9 (RPL9 Produits)
- Synonymes
- anticorps CG6141, anticorps Dmel\\CG6141, anticorps L9, anticorps M(2)32D, anticorps Rp L9, anticorps Rpl9, anticorps anon-EST:fe3A6, anticorps anon-WO0153538.25, anticorps anon-WO0153538.26, anticorps anon-WO0153538.27, anticorps rpL9, anticorps ab02c03, anticorps fa93a01, anticorps mg:ab02c03, anticorps wu:fa93a01, anticorps zgc:103730, anticorps NPC-A-16, anticorps Ribosomal protein L9, anticorps 60S ribosomal protein L9, anticorps ribosomal protein L9, anticorps ribosomal protein L9 L homeolog, anticorps RpL9, anticorps rpl-9, anticorps rpl9, anticorps rpl9.L, anticorps RPL9, anticorps Rpl9
- Sujet
- RPL9 is a ribosomal protein that is a component of the 60S subunit. RPL9 belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Poids moléculaire
- 21 kDa (MW of target protein)
-