Seryl-tRNA Synthetase (SARS) (C-Term) anticorps

N° du produit ABIN630017

Détail du produit

Antigène: Seryl-tRNA Synthetase (SARS)

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: SARS antibody was raised against the C terminal of SARS

Purification: Purified

Immunogène: SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SARS Blocking Peptide, catalog no. 33R-7048, is also available for use as a blocking control in assays to test for specificity of this SARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Seryl-tRNA Synthetase (SARS)

Autre désignation: SARS (SARS Produits)

Synonymes: anticorps SERRS, anticorps SERS, anticorps Sars1, anticorps Strs, anticorps serRS, anticorps SerRS, anticorps wu:fk51f08, anticorps zgc:92152, anticorps seryl-tRNA synthetase, anticorps seryl-aminoacyl-tRNA synthetase, anticorps SARS, anticorps Sars, anticorps sars

Sujet: SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Poids moléculaire: 57 kDa (MW of target protein)