PRP6/ANT-1 anticorps

N° du produit ABIN630022

Détail du produit anti-PRP6/ANT-1 anticorps

Antigène: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRP6/ANT-1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPF6 Blocking Peptide, catalog no. 33R-7111, is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRP6/ANT-1

Antigène: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Autre désignation: PRPF6 (PRPF6 Produits)

Synonymes: anticorps ANT-1, anticorps ANT1, anticorps C20orf14, anticorps Prp6, anticorps SNRNP102, anticorps TOM, anticorps U5-102K, anticorps hPrp6, anticorps 1190003A07Rik, anticorps 2610031L17Rik, anticorps RGD1307103, anticorps c20orf14, anticorps fc12b02, anticorps wu:fa05f07, anticorps wu:fc12b02, anticorps zgc:65913, anticorps pre-mRNA processing factor 6, anticorps pre-mRNA splicing factor 6, anticorps PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), anticorps pre-mRNA processing factor 6 L homeolog, anticorps PRPF6, anticorps Prpf6, anticorps prpf6, anticorps prpf6.L

Sujet: PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Poids moléculaire: 104 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport