MTHFSD anticorps (N-Term)
-
- Antigène Voir toutes MTHFSD Anticorps
- MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MTHFSD est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- MTHFSD antibody was raised against the N terminal of MTHFSD
- Purification
- Purified
- Immunogène
- MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL
- Top Product
- Discover our top product MTHFSD Anticorps primaire
-
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (AA 60-109) antibody
MTHFSD Reactivité: Humain, Souris, Chien, Lapin, Boeuf (Vache), Cheval, Poisson zèbre (Danio rerio) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (AA 43-69), (N-Term) antibodyMTHFSD Reactivité: Humain WB Hôte: Lapin Polyclonal RB37723 unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (N-Term) antibodyMTHFSD Reactivité: Humain, Souris, Chien, Lapin, Boeuf (Vache), Cheval, Cobaye, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (AA 1-383) antibodyMTHFSD Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (N-Term) antibodyMTHFSD Reactivité: Humain, Souris, Chien, Lapin, Boeuf (Vache), Cheval, Poisson zèbre (Danio rerio), Cobaye, Porc, Rat WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MTHFSD Blocking Peptide, catalog no. 33R-2798, is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFSD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))
- Autre désignation
- MTHFSD (MTHFSD Produits)
- Synonymes
- anticorps MTHFSD, anticorps DKFZp469G0629, anticorps fc43c12, anticorps si:dkey-199i24.1, anticorps wu:fc43c12, anticorps zgc:153374, anticorps AW049977, anticorps BC052066, anticorps C920004D05, anticorps methenyltetrahydrofolate synthetase domain containing, anticorps methenyltetrahydrofolate synthetase domain containing L homeolog, anticorps MTHFSD, anticorps mthfsd, anticorps mthfsd.L, anticorps Mthfsd
- Sujet
- The function remains unknows.
- Poids moléculaire
- 41 kDa (MW of target protein)
-
