THO Complex 3 anticorps (Middle Region)

N° du produit ABIN630029

Détail du produit anti-THO Complex 3 anticorps

Antigène: THO Complex 3 (THOC3)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THO Complex 3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: THOC3 antibody was raised against the middle region of THOC3

Purification: Purified

Immunogène: THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THOC3 Blocking Peptide, catalog no. 33R-7013, is also available for use as a blocking control in assays to test for specificity of this THOC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THO Complex 3

Antigène: THO Complex 3 (THOC3)

Autre désignation: THOC3 (THOC3 Produits)

Synonymes: anticorps THOC3, anticorps zgc:100815, anticorps THO3, anticorps hTREX45, anticorps 2410044K02Rik, anticorps AL033344, anticorps THO complex 3, anticorps THO complex subunit 3, anticorps THOC3, anticorps thoc3, anticorps LOC100400596, anticorps Thoc3

Sujet: THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.

Poids moléculaire: 39 kDa (MW of target protein)