RAVER1 anticorps (N-Term)

N° du produit ABIN630030

Détail du produit anti-RAVER1 anticorps

Antigène: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAVER1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RAVER1 antibody was raised against the N terminal of RAVER1

Purification: Purified

Immunogène: RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAVER1 Blocking Peptide, catalog no. 33R-9845, is also available for use as a blocking control in assays to test for specificity of this RAVER1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAVER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAVER1

Antigène: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Autre désignation: RAVER1 (RAVER1 Produits)

Synonymes: anticorps MGC83237, anticorps zgc:112236, anticorps RAVER1, anticorps Raver1h, anticorps 1300006N24Rik, anticorps AA050359, anticorps mKIAA1978, anticorps hypothetical protein, anticorps ribonucleoprotein, PTB-binding 1 S homeolog, anticorps ribonucleoprotein, PTB-binding 1, anticorps ribonucleoprotein, PTB binding 1, anticorps Raver1, anticorps raver1.S, anticorps raver1, anticorps RAVER1

Sujet: RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping.

Poids moléculaire: 67 kDa (MW of target protein)