ALKBH8 anticorps
-
- Antigène Voir toutes ALKBH8 Anticorps
- ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALKBH8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNV
- Top Product
- Discover our top product ALKBH8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALKBH8 Blocking Peptide, catalog no. 33R-2365, is also available for use as a blocking control in assays to test for specificity of this ALKBH8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))
- Autre désignation
- ALKBH8 (ALKBH8 Produits)
- Synonymes
- anticorps ABH8, anticorps 4930562C03Rik, anticorps 8030431D03Rik, anticorps 9430088N01Rik, anticorps Abh8, anticorps alkB homolog 8, tRNA methyltransferase, anticorps ALKBH8, anticorps Alkbh8
- Sujet
- ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA.
- Poids moléculaire
- 26 kDa (MW of target protein)
-