DIS3L2 anticorps (N-Term)
-
- Antigène Voir toutes DIS3L2 Anticorps
- DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DIS3L2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- MGC42174 antibody was raised against the N terminal Of Mgc42174
- Purification
- Purified
- Immunogène
- MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF
- Top Product
- Discover our top product DIS3L2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MGC42174 Blocking Peptide, catalog no. 33R-9966, is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC42174 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))
- Abstract
- DIS3L2 Produits
- Sujet
- MGC42174 is a probable exonuclease.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-