DIS3L2 anticorps (N-Term)

N° du produit ABIN630034

Détail du produit anti-DIS3L2 anticorps

Antigène: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DIS3L2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: MGC42174 antibody was raised against the N terminal Of Mgc42174

Purification: Purified

Immunogène: MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC42174 Blocking Peptide, catalog no. 33R-9966, is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC42174 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DIS3L2

Antigène: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Abstract: DIS3L2 Produits

Synonymes: anticorps RGD1560168, anticorps DIS3L2, anticorps DKFZp469O0522, anticorps FAM6A, anticorps PRLMNS, anticorps hDIS3L2, anticorps 4930429A22Rik, anticorps 8030493P09Rik, anticorps DIS3-like 3'-5' exoribonuclease 2, anticorps DIS3 like 3'-5' exoribonuclease 2, anticorps DIS3-like exonuclease 2, anticorps Dis3l2, anticorps DIS3L2, anticorps LOC100344728

Sujet: MGC42174 is a probable exonuclease.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Stem Cell Maintenance