HNRNPA3 anticorps (N-Term)

N° du produit ABIN630036

Détail du produit anti-HNRNPA3 anticorps

Antigène: HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPA3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HNRPA3 antibody was raised against the N terminal of HNRPA3

Purification: Purified

Immunogène: HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPA3 Blocking Peptide, catalog no. 33R-5978, is also available for use as a blocking control in assays to test for specificity of this HNRPA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPA3

Antigène: HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))

Autre désignation: HNRPA3 (HNRNPA3 Produits)

Synonymes: anticorps 2610510D13Rik, anticorps D10S102, anticorps FBRNP, anticorps HNRPA3, anticorps 2410013L13Rik, anticorps 2610209F03Rik, anticorps Hnrpa3, anticorps zgc:153703, anticorps DKFZp469I0118, anticorps heterogeneous nuclear ribonucleoprotein A3, anticorps heterogeneous nuclear ribonucleoprotein A3 S homeolog, anticorps heterogeneous nuclear ribonucleoprotein A1, anticorps hypothetical protein, anticorps HNRNPA3, anticorps Hnrnpa3, anticorps hnrnpa3.S, anticorps HNRNPA1, anticorps hnrnpa3, anticorps ARCVE_RS10260

Sujet: HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing

Poids moléculaire: 42 kDa (MW of target protein)