PCBP1 anticorps
-
- Antigène Voir toutes PCBP1 Anticorps
- PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCBP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
- Top Product
- Discover our top product PCBP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCBP1 Blocking Peptide, catalog no. 33R-1804, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))
- Autre désignation
- PCBP1 (PCBP1 Produits)
- Synonymes
- anticorps PCBP1, anticorps HNRPE1, anticorps HNRPX, anticorps hnRNP-E1, anticorps hnRNP-X, anticorps hnRNP E1, anticorps WBP17, anticorps [a]CP-1, anticorps alphaCP-1, anticorps RGD1561319, anticorps poly(rC) binding protein 1, anticorps poly(rC) binding protein 1 L homeolog, anticorps poly(rC)-binding protein 1, anticorps PCBP1, anticorps pcbp1.L, anticorps LOC100388387, anticorps Pcbp1
- Sujet
- PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA.
- Poids moléculaire
- 39 kDa (MW of target protein)
-