RPL13 anticorps (C-Term)
-
- Antigène Voir toutes RPL13 Anticorps
- RPL13 (Ribosomal Protein L13 (RPL13))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPL13 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPL13 antibody was raised against the C terminal of RPL13
- Purification
- Purified
- Immunogène
- RPL13 antibody was raised using the C terminal of RPL13 corresponding to a region with amino acids KGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMA
- Top Product
- Discover our top product RPL13 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPL13 Blocking Peptide, catalog no. 33R-4385, is also available for use as a blocking control in assays to test for specificity of this RPL13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPL13 (Ribosomal Protein L13 (RPL13))
- Autre désignation
- RPL13 (RPL13 Produits)
- Synonymes
- anticorps BBC1, anticorps D16S444E, anticorps D16S44E, anticorps L13, anticorps ZNF219, anticorps A52, anticorps zgc:92272, anticorps Bbc1, anticorps CG4651, anticorps Dmbbc1, anticorps Dmel\\CG4651, anticorps Rp L13, anticorps Rpl13, anticorps anon-EST:fe1D1, anticorps bbc1, anticorps rpL13, anticorps ribosomal protein L13, anticorps zinc finger protein 219, anticorps likely cytosolic ribosomal protein similar to S. cerevisiae RPL13A (YDL082W) and RPL13B (YMR142C) large subunit protein L13, anticorps 60S ribosomal protein L13, anticorps ribosomal protein L13 S homeolog, anticorps Ribosomal protein L13, anticorps RPL13, anticorps ZNF219, anticorps Rpl13, anticorps rpl-13, anticorps rpl13, anticorps rpl13.S, anticorps RpL13
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL13 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas.
- Poids moléculaire
- 23 kDa (MW of target protein)
-