RPL32 anticorps (N-Term)

N° du produit ABIN630044

Détail du produit anti-RPL32 anticorps

Antigène: RPL32 (Ribosomal Protein L32 (RPL32))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL32 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPL32 antibody was raised against the N terminal of RPL32

Purification: Purified

Immunogène: RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL32 Blocking Peptide, catalog no. 33R-1035, is also available for use as a blocking control in assays to test for specificity of this RPL32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL32

Antigène: RPL32 (Ribosomal Protein L32 (RPL32))

Autre désignation: RPL32 (RPL32 Produits)

Synonymes: anticorps L32, anticorps AU020185, anticorps rpL32-3A, anticorps zgc:136952, anticorps 143250_at, anticorps BcDNA:RH03940, anticorps CG7939, anticorps Dmel\\CG7939, anticorps M(3)99D, anticorps RP-49, anticorps RP49, anticorps RPL32, anticorps Rp-49, anticorps Rp49, anticorps Rp49/RpL32, anticorps Rpl32, anticorps bs30a02.y1, anticorps rp49, anticorps rp49/RpL32, anticorps ribosomal protein L32, anticorps 50S ribosomal protein L32, anticorps rpl32, anticorps ribosomal protein L32 L homeolog, anticorps Ribosomal protein L32, anticorps ribosomal protein L32 homolog32, anticorps RPL32, anticorps rpl32, anticorps Rpl32, anticorps rpl32.L, anticorps RpL32

Sujet: RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Poids moléculaire: 15 kDa (MW of target protein)