DDX17 anticorps

N° du produit ABIN630050

Détail du produit anti-DDX17 anticorps

Antigène: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX17 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX17 Blocking Peptide, catalog no. 33R-9297, is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX17

Antigène: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Autre désignation: DDX17 (DDX17 Produits)

Synonymes: anticorps MGC80019, anticorps DDX17, anticorps P72, anticorps RH70, anticorps Cp68, anticorps DDX46, anticorps 2610007K22Rik, anticorps A430025E01Rik, anticorps AI047725, anticorps C80929, anticorps Gm926, anticorps p72, anticorps DEAD-box helicase 17 L homeolog, anticorps probable ATP-dependent RNA helicase DDX17, anticorps DEAD-box helicase 17, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, anticorps ddx17.L, anticorps LOC412313, anticorps DDX17, anticorps ddx17, anticorps Ddx17

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Muscle Cell Differentiation