TMED4 anticorps (N-Term)
-
- Antigène Voir toutes TMED4 Anticorps
- TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMED4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- TMED4 antibody was raised against the N terminal of TMED4
- Purification
- Purified
- Immunogène
- TMED4 antibody was raised using the N terminal of TMED4 corresponding to a region with amino acids LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
- Top Product
- Discover our top product TMED4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMED4 Blocking Peptide, catalog no. 33R-5347, is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))
- Autre désignation
- TMED4 (TMED4 Produits)
- Synonymes
- anticorps TMED4, anticorps ERS25, anticorps HNLF, anticorps 1110014L17Rik, anticorps AI326346, anticorps fc88h09, anticorps wu:fc88h09, anticorps zgc:86755, anticorps ers25, anticorps hnlf, anticorps RGD1306319, anticorps transmembrane p24 trafficking protein 4, anticorps transmembrane p24 trafficking protein 4 S homeolog, anticorps TMED4, anticorps Tmed4, anticorps tmed4, anticorps tmed4.S
- Sujet
- TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
- Poids moléculaire
- 25 kDa (MW of target protein)
-