CLCN3 anticorps (C-Term)

N° du produit ABIN630057

Détail du produit anti-CLCN3 anticorps

Antigène: CLCN3 (Chloride Channel 3 (CLCN3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLCN3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CLCN3 antibody was raised against the C terminal of CLCN3

Purification: Purified

Immunogène: CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLCN3 Blocking Peptide, catalog no. 33R-5956, is also available for use as a blocking control in assays to test for specificity of this CLCN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLCN3

Antigène: CLCN3 (Chloride Channel 3 (CLCN3))

Autre désignation: CLCN3 (CLCN3 Produits)

Synonymes: anticorps CLC3, anticorps ClC-3, anticorps Clc3, anticorps CLCN3, anticorps fb78c02, anticorps wu:fb78c02, anticorps clc3, anticorps clc-3, anticorps chloride voltage-gated channel 3, anticorps chloride channel, voltage-sensitive 3, anticorps chloride channel 3, anticorps chloride channel protein 3, anticorps chloride channel, voltage-sensitive 3 S homeolog, anticorps CLCN3, anticorps Clcn3, anticorps clcn3, anticorps PTRG_03131, anticorps BDBG_05668, anticorps MCYG_04420, anticorps clcn3.S

Sujet: CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).

Poids moléculaire: 95 kDa (MW of target protein)