KCTD11 anticorps (N-Term)
-
- Antigène Voir toutes KCTD11 Anticorps
- KCTD11 (Potassium Channel Tetramerisation Domain Containing 11 (KCTD11))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCTD11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCTD11 antibody was raised against the N terminal of KCTD11
- Purification
- Purified
- Immunogène
- KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
- Top Product
- Discover our top product KCTD11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCTD11 Blocking Peptide, catalog no. 33R-1090, is also available for use as a blocking control in assays to test for specificity of this KCTD11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCTD11 (Potassium Channel Tetramerisation Domain Containing 11 (KCTD11))
- Autre désignation
- KCTD11 (KCTD11 Produits)
- Synonymes
- anticorps KCTD11, anticorps AF465352, anticorps Ren, anticorps C17orf36, anticorps KCASH1, anticorps REN, anticorps REN/KCTD11, anticorps potassium channel tetramerization domain containing 11, anticorps potassium channel tetramerisation domain containing 11, anticorps KCTD11, anticorps Kctd11
- Sujet
- The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog
-