CLIC2 anticorps (C-Term)

N° du produit ABIN630069

Détail du produit anti-CLIC2 anticorps

Antigène: CLIC2 (Chloride Intracellular Channel 2 (CLIC2))

Épitope: C-Term

Reactivité: Humain, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLIC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CLIC2 antibody was raised against the C terminal of CLIC2

Purification: Purified

Immunogène: CLIC2 antibody was raised using the C terminal of CLIC2 corresponding to a region with amino acids SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLIC2 Blocking Peptide, catalog no. 33R-8293, is also available for use as a blocking control in assays to test for specificity of this CLIC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLIC2

Antigène: CLIC2 (Chloride Intracellular Channel 2 (CLIC2))

Autre désignation: CLIC2 (CLIC2 Produits)

Synonymes: anticorps zgc:92762, anticorps CLIC2, anticorps CLIC2b, anticorps MRXS32, anticorps XAP121, anticorps chloride intracellular channel 2, anticorps clic2, anticorps CLIC2, anticorps Clic2

Sujet: Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity