KCTD10 anticorps (N-Term)
-
- Antigène Voir toutes KCTD10 Anticorps
- KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCTD10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCTD10 antibody was raised against the N terminal of KCTD10
- Purification
- Purified
- Immunogène
- KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL
- Top Product
- Discover our top product KCTD10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCTD10 Blocking Peptide, catalog no. 33R-5908, is also available for use as a blocking control in assays to test for specificity of this KCTD10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))
- Autre désignation
- KCTD10 (KCTD10 Produits)
- Synonymes
- anticorps kctd10, anticorps KCTD10, anticorps wu:fb30g12, anticorps zgc:63846, anticorps AW536343, anticorps C87062, anticorps mBACURD3, anticorps BTBD28, anticorps ULRO61, anticorps hBACURD3, anticorps potassium channel tetramerization domain containing 10, anticorps potassium channel tetramerisation domain containing 10, anticorps potassium channel tetramerization domain containing 10 L homeolog, anticorps KCTD10, anticorps kctd10, anticorps Kctd10, anticorps kctd10.L
- Sujet
- KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.
- Poids moléculaire
- 34 kDa (MW of target protein)
-