KCTD18 anticorps (N-Term)

N° du produit ABIN630077

Détail du produit anti-KCTD18 anticorps

Antigène: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD18 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCTD18 antibody was raised against the N terminal of KCTD18

Purification: Purified

Immunogène: KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD18 Blocking Peptide, catalog no. 33R-5035, is also available for use as a blocking control in assays to test for specificity of this KCTD18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD18

Antigène: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Autre désignation: KCTD18 (KCTD18 Produits)

Synonymes: anticorps KCTD18, anticorps 4932411A20Rik, anticorps 6530404F10Rik, anticorps RGD1564820, anticorps potassium channel tetramerization domain containing 18, anticorps potassium channel tetramerization domain containing 18 L homeolog, anticorps potassium channel tetramerisation domain containing 18, anticorps KCTD18, anticorps kctd18.L, anticorps Kctd18

Sujet: The function of Anti-KCTD18 has not yet been determined.

Poids moléculaire: 47 kDa (MW of target protein)