KCNRG anticorps (N-Term)

N° du produit ABIN630080

Détail du produit anti-KCNRG anticorps

Antigène: KCNRG (Potassium Channel Regulator (KCNRG))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNRG est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNRG antibody was raised against the N terminal of KCNRG

Purification: Purified

Immunogène: KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNRG Blocking Peptide, catalog no. 33R-9475, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNRG

Antigène: KCNRG (Potassium Channel Regulator (KCNRG))

Autre désignation: KCNRG (KCNRG Produits)

Synonymes: anticorps DLTET, anticorps Clld4, anticorps E030012H22Rik, anticorps Gm745, anticorps putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, anticorps potassium channel regulator, anticorps LOC5569660, anticorps KCNRG, anticorps Kcnrg

Sujet: KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.

Poids moléculaire: 31 kDa (MW of target protein)