ASIC3 anticorps (N-Term)
-
- Antigène Voir toutes ASIC3 (ACCN3) Anticorps
- ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ASIC3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ACCN3 antibody was raised against the N terminal of ACCN3
- Purification
- Purified
- Immunogène
- ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
- Top Product
- Discover our top product ACCN3 Anticorps primaire
-
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 62-320) antibody
ACCN3 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 53-102) antibodyACCN3 Reactivité: Humain, Rat, Souris, Lapin, Boeuf (Vache), Chien, Cobaye, Cheval WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) antibodyACCN3 Reactivité: Humain, Rat, Souris, Lapin, Boeuf (Vache), Chien, Cobaye, Cheval, Porc WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 2-16), (Intracellular), (N-Term) antibodyACCN3 Reactivité: Rat, Souris WB, IHC, IF Hôte: Cobaye Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 55-83), (N-Term) antibodyACCN3 Reactivité: Humain WB Hôte: Lapin Polyclonal RB40995 unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 1-549) antibodyACCN3 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 2-16), (Intracellular), (N-Term) antibodyACCN3 Reactivité: Humain, Rat, Souris WB, IHC, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (Internal Region) antibodyACCN3 Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACCN3 Blocking Peptide, catalog no. 33R-9439, is also available for use as a blocking control in assays to test for specificity of this ACCN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))
- Autre désignation
- ACCN3 (ACCN3 Produits)
- Synonymes
- anticorps ACCN3, anticorps Accn3, anticorps DRASIC, anticorps SLNAC1, anticorps TNaC1, anticorps AW742291, anticorps TNAC1, anticorps amiloride-sensitive cation channel 3, anticorps acid sensing ion channel subunit 3, anticorps acid-sensing (proton-gated) ion channel 3, anticorps ACCN3, anticorps ASIC3, anticorps Asic3
- Sujet
- ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.
- Poids moléculaire
- 58 kDa (MW of target protein)
-
