KCNK10 anticorps (C-Term)

N° du produit ABIN630105

Détail du produit anti-KCNK10 anticorps

Antigène: KCNK10 (Potassium Channel, Subfamily K, Member 10 (KCNK10))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK10 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK10 antibody was raised against the C terminal of KCNK10

Purification: Purified

Immunogène: KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids EDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELEN

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK10 Blocking Peptide, catalog no. 33R-2331, is also available for use as a blocking control in assays to test for specificity of this KCNK10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK10

Antigène: KCNK10 (Potassium Channel, Subfamily K, Member 10 (KCNK10))

Autre désignation: KCNK10 (KCNK10 Produits)

Synonymes: anticorps KCNK10, anticorps K2p10.1, anticorps TREK-2, anticorps TREK2, anticorps 1700024D23Rik, anticorps 3010005K24Rik, anticorps Trek2, anticorps k2p10.1, anticorps trek-2, anticorps trek2, anticorps potassium two pore domain channel subfamily K member 10, anticorps potassium channel, subfamily K, member 10, anticorps potassium channel, two pore domain subfamily K, member 10 L homeolog, anticorps KCNK10, anticorps Kcnk10, anticorps kcnk10.L

Sujet: KCNK10 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene.

Poids moléculaire: 59 kDa (MW of target protein)