KCNK13 anticorps (C-Term)

N° du produit ABIN630111

Détail du produit anti-KCNK13 anticorps

Antigène: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK13 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK13 antibody was raised against the C terminal of KCNK13

Purification: Purified

Immunogène: KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK13 Blocking Peptide, catalog no. 33R-8639, is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK13

Antigène: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Autre désignation: KCNK13 (KCNK13 Produits)

Synonymes: anticorps BB085247, anticorps F730021E22Rik, anticorps Gm1570, anticorps Gm1685, anticorps K2p13.1, anticorps THIK-1, anticorps THIK1, anticorps prdx1, anticorps kcnk13, anticorps si:ch211-173b9.3, anticorps zgc:171694, anticorps potassium channel, subfamily K, member 13, anticorps potassium two pore domain channel subfamily K member 13, anticorps potassium channel subfamily K member 13, anticorps potassium channel, subfamily K, member 13b, anticorps potassium channel, subfamily K, member 13a, anticorps Kcnk13, anticorps KCNK13, anticorps Tsp_07890, anticorps kcnk13b, anticorps kcnk13a

Sujet: KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of KCNK13 is an open channel that can be stimulated by arachidonic acid.

Poids moléculaire: 45 kDa (MW of target protein)