NMUR2 anticorps (N-Term)

N° du produit ABIN630112

Détail du produit anti-NMUR2 anticorps

Antigène: NMUR2 (Neuromedin U Receptor 2 (NMUR2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NMUR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NMUR2 antibody was raised against the N terminal of NMUR2

Purification: Purified

Immunogène: NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NMUR2 Blocking Peptide, catalog no. 33R-6432, is also available for use as a blocking control in assays to test for specificity of this NMUR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMUR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NMUR2

Antigène: NMUR2 (Neuromedin U Receptor 2 (NMUR2))

Autre désignation: NMUR2 (NMUR2 Produits)

Synonymes: anticorps NMUR2, anticorps NMSR2, anticorps FM-4, anticorps FM4, anticorps NMU-R2, anticorps NMU2R, anticorps TGR-1, anticorps TGR1, anticorps Nmu2r, anticorps neuromedin U receptor 2, anticorps NMUR2, anticorps Nmur2

Sujet: NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Feeding Behaviour