GABRG2 anticorps

N° du produit ABIN630118

Détail du produit anti-GABRG2 anticorps

Antigène: GABRG2 (gamma-aminobutyric Acid (GABA) A Receptor, gamma 2 (GABRG2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRG2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRG2 Blocking Peptide, catalog no. 33R-1384, is also available for use as a blocking control in assays to test for specificity of this GABRG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRG2

Antigène: GABRG2 (gamma-aminobutyric Acid (GABA) A Receptor, gamma 2 (GABRG2))

Autre désignation: GABRG2 (GABRG2 Produits)

Synonymes: anticorps cae2, anticorps eca2, anticorps gabrg1, anticorps gefsp3, anticorps si:ch211-145n14.1, anticorps CAE2, anticorps ECA2, anticorps GEFSP3, anticorps GABAA-R, anticorps Gabrg-2, anticorps gamma2, anticorps gamma-aminobutyric acid type A receptor gamma2 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, gamma 2, anticorps gamma-aminobutyric acid type A receptor gamma 2 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2, anticorps GABRG2, anticorps gabrg2, anticorps Gabrg2

Sujet: Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. GABRG2 is the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures.

Poids moléculaire: 36 kDa (MW of target protein)