FZD9 anticorps

N° du produit ABIN630125

Détail du produit anti-FZD9 anticorps

Antigène: FZD9 (Frizzled Family Receptor 9 (FZD9))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD9 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD9 Blocking Peptide, catalog no. 33R-8100, is also available for use as a blocking control in assays to test for specificity of this FZD9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD9

Antigène: FZD9 (Frizzled Family Receptor 9 (FZD9))

Autre désignation: FZD9 (FZD9 Produits)

Synonymes: anticorps CD349, anticorps FZD3, anticorps mfz9, anticorps Fz-9, anticorps cFz-9, anticorps fz11, anticorps fzd9, anticorps fzx, anticorps hm:zehl0603, anticorps zehl0603, anticorps zg11, anticorps frizzled class receptor 9, anticorps frizzled class receptor 9a, anticorps frizzled class receptor 9b, anticorps FZD9, anticorps Fzd9, anticorps fzd9a, anticorps fzd9b

Sujet: FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Signalisation WNT